Antibodies

View as table Download

KIR2DL4 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 302~332 amino acids from the C-terminal region of human CD158d / KIR2DL4

KIR2DL4 (L1, L3, L4, S4) mouse monoclonal antibody, clone 2H6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

KIR2DL4 (L1, L3, L4, S4) mouse monoclonal antibody, clone 2H6, Purified

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated

KIR2DL4 mouse monoclonal antibody, clone mAb#33, Aff - Purified

Applications FC, FN, IF, IP
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-KIR2DL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KIR2DL4 antibody: synthetic peptide directed towards the middle region of human KIR2DL4. Synthetic peptide located within the following region: VSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHR

KIR2DL4 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-KIR2DL4 antibody is: synthetic peptide directed towards the C-terminal region of Human KI2L4

KIR2DL4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-242 of human KIR2DL4 (NP_002246.5).
Modifications Unmodified