Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
Anti-YWHAQ Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 140-154 amino acids of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide |
USD 430.00
3 Weeks
USD 315.00
3 Weeks
Rabbit Polyclonal Anti-YWHAQ Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAQ antibody: synthetic peptide directed towards the N terminal of human YWHAQ. Synthetic peptide located within the following region: SVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSIC |
Goat Polyclonal Antibody against YWHAQ
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DDRKQTIDNSQ, from the internal region of the protein sequence according to NP_006817.1. |
YWHAQ Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human YWHAQ |
Rabbit polyclonal anti-14-3-3 theta antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human 14-3-3 ?. |
YWHAQ Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human YWHAQ |
Germany
Japan
United Kingdom
China
