Antibodies

Jump to Filters
View as table Download
DGKA Mouse Monoclonal Antibody [Clone ID: OTI7B6]
TA504048S

USD 200.00

2 Days

DGKA mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DGKA Mouse Monoclonal Antibody [Clone ID: OTI3G7]
TA504024S

USD 200.00

In Stock

DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)

Applications FC, WB
Reactivities Human, Dog, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DGKA Rabbit Polyclonal Antibody
TA311874

USD 380.00

In Stock

Rabbit polyclonal anti-DGKA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKA.
DGKA Rabbit Polyclonal Antibody
TA337619

USD 539.00

5 Days

Rabbit Polyclonal Anti-DGKA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL
DGKA Mouse Monoclonal Antibody [Clone ID: OTI6A11]
TA504050S

USD 200.00

2 Days

DGKA mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

DGKA Mouse Monoclonal Antibody [Clone ID: OTI8G5]
TA504155S

USD 200.00

2 Days

DGKA mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)

Applications IF, WB
Reactivities Human, Dog, Monkey
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".