DGKA mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI7B6 (formerly 7B6)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
Applications | FC, WB |
Reactivities | Human, Dog, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal anti-DGKA antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKA. |
Rabbit Polyclonal Anti-DGKA Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKA antibody: synthetic peptide directed towards the N terminal of human DGKA. Synthetic peptide located within the following region: EGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSEL |
DGKA mouse monoclonal antibody, clone OTI6A11 (formerly 6A11)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IF, WB |
Reactivities | Human, Dog, Monkey |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI6B3 (formerly 6B3)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
DGKA mouse monoclonal antibody, clone OTI4H10 (formerly 4H10)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".