Antibodies

Jump to Filters
View as table Download
ASB3 Rabbit Polyclonal Antibody
TA349688

USD 380.00

In Stock

Rabbit Polyclonal Anti-ASB3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ASB3
ASB3 Rabbit Polyclonal Antibody
TA344629

USD 539.00

5 Days

Rabbit Polyclonal Anti-ASB3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASB3 antibody: synthetic peptide directed towards the middle region of human ASB3. Synthetic peptide located within the following region: LEIRSSLKSERLRSDSYISQLPLPRSLHNYLLYEDVLRMYEVPELAAIQD