Antibodies

Jump to Filters
View as table Download
KAT2B Rabbit Polyclonal Antibody
TA308325

USD 625.00

2 Weeks

Rabbit Polyclonal antibody to PCAF (K(lysine) acetyltransferase 2B)

Applications WB
Reactivities Human, Mouse (Predicted: Zebrafish)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 767 and 832 of PCAF (Uniprot ID#Q92831)
KAT2B Rabbit Polyclonal Antibody
TA590645

USD 482.00

In Stock

Rabbit Polyclonal PCAF Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
KAT2B Rabbit Polyclonal Antibody
TA325604

USD 380.00

4 Weeks

Rabbit Polyclonal p300/CBP Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human PCAF.
KAT2B Rabbit Polyclonal Antibody
TA330554

USD 485.00

5 Days

Rabbit Polyclonal Anti-PCAF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the N terminal of human PCAF. Synthetic peptide located within the following region: LFKLLRKSILQRGKPVVEGSLEKKPPFEKPSIEQGVNNFVQYKFSHLPAK
KAT2B Rabbit Polyclonal Antibody
TA344545

USD 539.00

5 Days

Rabbit Polyclonal Anti-PCAF Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCAF antibody: synthetic peptide directed towards the C terminal of human PCAF. Synthetic peptide located within the following region: PGLSCFKDGVRQIPIESIPGIRETGWKPSGKEKSKEPRDPDQLYSTLKSI