Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal E2F-1 phospho S364 antibody
| Applications | IHC, WB |
| Reactivities | Human, Chimpanzee |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 360-369 of Human E2F-1. |
Rabbit Polyclonal E2F1 (Thr433) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 around the phosphorylation site of Threonine 433 |
| Modifications | Phospho-specific |
Rabbit Polyclonal E2F1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human E2F1 |
Rabbit Polyclonal Anti-E2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the N terminal of human E2F1. Synthetic peptide located within the following region: PARGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSHSADGVVDLNWA |
Rabbit Polyclonal Anti-E2F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F1 antibody: synthetic peptide directed towards the C terminal of human E2F1. Synthetic peptide located within the following region: REDFSGLLPEEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF |
Rabbit Polyclonal Anti-E2F-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F-1 Antibody: Peptide sequence around aa.430~434(G-D-L-T-P) derived from Human E2F-1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- E2F1
Isotypes
- IgG
Conjugates
- Unconjugated
Pathways
- Glioma