Antibodies

Jump to Filters
View as table Download
IDH2 Rabbit Polyclonal Antibody
TA350076

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-IDH2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IDH2
IDH2 Rabbit Polyclonal Antibody
TA319664

USD 570.00

2 Weeks

Rabbit Polyclonal IDH2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.
IDH2 Rabbit Polyclonal Antibody
TA346571

USD 539.00

5 Days

Rabbit Polyclonal Anti-IDH2 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-IDH2 antibody: synthetic peptide directed towards the middle region of human IDH2. Synthetic peptide located within the following region: GGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYKATDFVADRAGTFK