Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-B3GALT4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B3GALT4. |
Antibodies
View as table Download
Rabbit polyclonal Anti-ST6GALNAC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST6GALNAC3 antibody: synthetic peptide directed towards the C terminal of human ST6GALNAC3. Synthetic peptide located within the following region: HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT |
Rabbit anti-HEXA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human HEXA |
Rabbit Polyclonal Anti-ST6GALNAC5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST6GALNAC5 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC5. Synthetic peptide located within the following region: AFMITRHKMLQFDELFKQETGKDRKISNTWLSTGWFTMTIALELCDRINV |
Rabbit Polyclonal Anti-ST6GALNAC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ST6GALNAC6 antibody: synthetic peptide directed towards the N terminal of human ST6GALNAC6. Synthetic peptide located within the following region: ALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKT |
Active filters
Category
- Antibodies
Isotypes
- IgG
Conjugates
- Unconjugated
Pathways
- Glycosphingolipid biosynthesis - ganglio series