Antibodies

Jump to Filters
View as table Download
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA350861

USD 380.00

In Stock

Rabbit Polyclonal Anti-APOL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOL2
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA312421

USD 380.00

In Stock

Rabbit polyclonal anti-APOL2 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human APOL2.
Apolipoprotein L 2 (APOL2) Goat Polyclonal Antibody
TA305689

USD 520.00

5 Days

Goat Anti-APOL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKIHEMLQPGQD, from the C Terminus of the protein sequence according to NP_112092.1; NP_663612.1.
Apolipoprotein L 2 (APOL2) Rabbit Polyclonal Antibody
TA339568

USD 539.00

5 Days

Rabbit Polyclonal Anti-APOL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOL2 antibody: synthetic peptide directed towards the middle region of human APOL2. Synthetic peptide located within the following region: DVVSLAYESKHLLEGAKSESAEELKKRAQELEGKLNFLTKIHEMLQPGQD