Antibodies

View as table Download

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3D4 (formerly 3D4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

NEU1 mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-NEU1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NEU1 antibody: synthetic peptide directed towards the middle region of human NEU1. Synthetic peptide located within the following region: VWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHG

NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3H4 (formerly 3H4)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3F5 (formerly 3F5)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3B8 (formerly 3B8)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3C5 (formerly 3C5)

Applications WB
Reactivities Human
Conjugation Unconjugated

NEU1 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3H2 (formerly 3H2)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NEU1 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications WB
Reactivities Human
Conjugation Unconjugated