Antibodies

Jump to Filters
View as table Download
NGF Rabbit Polyclonal Antibody
TA349414

USD 380.00

2 Weeks

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF
EGFR Rabbit Polyclonal Antibody
TA312545

USD 380.00

4 Weeks

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).
FGF 23 (FGF23) Rabbit Monoclonal Antibody [Clone ID: OTIR5D11]
TA592951

USD 428.00

In Stock

FGF23 Rabbit monoclonal antibody,clone OTIR5D11

Applications WB
Reactivities Human
Conjugation Unconjugated
TGF beta 1 (TGFB1) Rabbit Polyclonal Antibody
TA313319

USD 380.00

4 Weeks

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.
BDNF Rabbit Polyclonal Antibody
TA319152

USD 765.00

In Stock

Rabbit polyclonal anti-BDNF antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli.
KGF (FGF7) Rabbit Polyclonal Antibody
TA321423

USD 380.00

2 Weeks

Anti-FGF7 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 179-182 amino acids of Human Fibroblast growth factor 7
Neurotrophin 4 (NTF4) Rabbit Polyclonal Antibody
TA322527

USD 380.00

In Stock

Anti-NTF4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-210 amino acids of human neurotrophin 4
FGF3 Rabbit Polyclonal Antibody
TA322644

USD 380.00

In Stock

Anti-FGF3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 226-239 amino acids of Human fibroblast growth factor 3
IL1 alpha (IL1A) Rabbit Polyclonal Antibody
TA349352

USD 380.00

In Stock

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A
FGF18 Rabbit Polyclonal Antibody
TA349977

USD 380.00

In Stock

Rabbit Polyclonal Anti-FGF18 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human FGF18
BDNF Rabbit Polyclonal Antibody
TA346304

USD 539.00

5 Days

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Mouse, Human, Macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG
FGF1 Rabbit Polyclonal Antibody
TA323919

USD 380.00

4 Weeks

Anti-FGF1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 41-55 amino acids of Human Fibroblast growth factor 1
TNFRSF1A Rabbit Polyclonal Antibody
TA328458

USD 314.00

In Stock

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I
FGF 23 (FGF23) Goat Polyclonal Antibody
TA303182

USD 520.00

In Stock

Goat Polyclonal Antibody against FGF23

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RHTRSAEDDSERD, from the internal region of the protein sequence according to NP_065689.1.
FGF21 Goat Polyclonal Antibody
TA303289

USD 520.00

In Stock

Goat Polyclonal Antibody against FGF21

Applications ICC/IF, IF
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence CQRPDGALYGSLH, from the internal region of the protein sequence according to NP_061986.1.