Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Carrier-free (BSA/glycerol-free) COPS5 mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
COPS5 (JAB1) mouse monoclonal antibody, clone OTI2B12 (formerly 2B12)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-COPS5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COPS5 antibody: synthetic peptide directed towards the N terminal of human COPS5. Synthetic peptide located within the following region: AASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHY |
Rabbit polyclonal anti-COPS5 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human COPS5. |
JAB1 (COPS5) (N-term) rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from N-terminal of human JAB1 protein |
Rabbit anti-COPS5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human COPS5 |
Active filters
Category
- Antibodies
Target Symbol
- JAB1
Reactivities
- Mouse
Conjugates
- Unconjugated
Families
- Protease