Antibodies

Jump to Filters
View as table Download
ADAM15 Rabbit Polyclonal Antibody
TA324248

USD 380.00

4 Weeks

Anti-ADAM15 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 213-414 amino acids of human ADAM metallopeptidase domain 15
ADAM15 Rabbit Polyclonal Antibody
TA324249

USD 380.00

In Stock

Anti-ADAM15 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 213-414 amino acids of human ADAM metallopeptidase domain 15
ADAM15 Rabbit Polyclonal Antibody
TA339378

USD 539.00

5 Days

Rabbit Polyclonal Anti-ADAM15 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ADAM15 antibody: synthetic peptide directed towards the middle region of human ADAM15. Synthetic peptide located within the following region: QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ
ADAM15 Rabbit Polyclonal Antibody
TA310038

USD 360.00

3 Weeks

Rabbit anti-ADAM15 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH