Antibodies

Jump to Filters
View as table Download
BDKRB2 Rabbit Polyclonal Antibody
TA321168

USD 380.00

4 Weeks

Anti-BDKRB2 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2
TA321168 is a possible alternative to TA321167.
BDKRB2 Rabbit Polyclonal Antibody
TA321167

USD 380.00

In Stock

Anti-BDKRB2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 377-391 amino acids of human bradykinin receptor B2
BDKRB2 Rabbit Polyclonal Antibody
TA346209

USD 485.00

5 Days

Rabbit Polyclonal Anti-BDKRB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BDKRB2 antibody: synthetic peptide directed towards the N terminal of human BDKRB2. Synthetic peptide located within the following region: MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQV