Antibodies

Jump to Filters
View as table Download
TAT Rabbit Polyclonal Antibody
TA323688

USD 380.00

2 Weeks

Anti-TAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from C terminal 250 amino acids of human tyrosine aminotransferase
TAT Rabbit Polyclonal Antibody
TA590802

USD 482.00

In Stock

Rabbit Polyclonal TAT Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.
Thyroid Peroxidase (TPO) Rabbit Polyclonal Antibody
TA335246

USD 539.00

5 Days

Rabbit Polyclonal Anti-TPO Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TPO antibody is: synthetic peptide directed towards the N-terminal region of Human TPO. Synthetic peptide located within the following region: GASNTALARWLPPVYEDGFSQPRGWNPGFLYNGFPLPPVREVTRHVIQVS