Rabbit Polyclonal Anti-OMA1 Antibody
| Applications | WB |
| Reactivities | Human, Fish |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA |
Rabbit polyclonal anti-ATR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Monkey, Dog, Xenopus, Rat, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human ATR protein. |
Rabbit polyclonal anti-PCNA antibody
| Applications | WB |
| Reactivities | Human, Monkey, Dog, Mouse, Bovine, Xenopus, Rat, Chicken, Fish |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human PCNA protein. |
VIP rabbit polyclonal antibody, Serum
| Applications | IHC |
| Reactivities | Feline, Fish, Human, Mammalian, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified porcine VIP. |
Germany
Japan
United Kingdom
China
