Antibodies

View as table Download

EIF4B pSer422 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human eIF4B around the phosphorylation site of Serine 422 (T-G-Sp-E-S).

EIF4B pSer422 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from Human eIF4B around the phosphorylation site of Serine 422 (T-G-Sp-E-S).

EIF4B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 420~424 (T-G-S-E-S) derived from Human eIF4B.

EIF4B rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 420~424 (T-G-S-E-S) derived from Human eIF4B.

Rabbit Polyclonal Anti-EIF4B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the C terminal of human EIF4B. Synthetic peptide located within the following region: NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQ

Rabbit Polyclonal Anti-EIF4B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-EIF4B antibody: synthetic peptide directed towards the middle region of human EIF4B. Synthetic peptide located within the following region: QTGNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFS

Rabbit Polyclonal Anti-eIF4B Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B Antibody: A synthesized peptide derived from human eIF4B

Rabbit Polyclonal Anti-eIF4B (Phospho-Ser422) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-eIF4B (Phospho-Ser422) Antibody: A synthesized peptide derived from human eIF4B (Phospho-Ser422)
Modifications Phospho-specific