Antibodies

Jump to Filters
View as table Download
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA312926

USD 380.00

4 Weeks

Rabbit polyclonal anti-p15 INK antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human p15 INK antibody.
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
AP06261PU-N

USD 465.00

3 Weeks

p15 INK4b (CDKN2B) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human p15 INK4b.
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA348038

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA330369

USD 539.00

5 Days

Rabbit Polyclonal Anti-CDKN2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDKN2B antibody: synthetic peptide directed towards the middle region of human CDKN2B. Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA347448

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-p15 INK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-p15 INK Antibody: A synthesized peptide derived from human p15 INK
p15 INK4b (CDKN2B) Rabbit Polyclonal Antibody
TA354868

USD 425.00

5 Days

Rabbit anti p15INK4b Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated