Antibodies

Jump to Filters
View as table Download
IL4R Rabbit Polyclonal Antibody
AP20570PU-N

USD 445.00

3 Weeks

IL4R rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acids 220-265 of Human IL-4Rα.
IL4R Rabbit Polyclonal Antibody
AP01360PU-N

USD 465.00

3 Weeks

IL4R rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 460-510 of Human IL-4Rα.
IL4R Rabbit Polyclonal Antibody
TA343045

USD 539.00

5 Days

Rabbit Polyclonal Anti-IL4R Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IL4R antibody is: synthetic peptide directed towards the C-terminal region of Human IL4R. Synthetic peptide located within the following region: GLDREPPRSPQSSHLPSSSPEHLGLEPGEKVEDMPKPPLPQEQATDPLVD