Antibodies

Jump to Filters
View as table Download
Apg12 (ATG12) Goat Polyclonal Antibody
AB0083-200

USD 355.00

In Stock

Goat Polyclonal Anti-ATG12 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 65 aa to the N-terminus of human ATG12 produced in E. coli.
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA349483

USD 380.00

In Stock

Rabbit Polyclonal Anti-ATG12 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ATG12
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA306511

USD 570.00

5 Days

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ATG12.
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA306512

USD 570.00

5 Days

Rabbit Polyclonal ATG12 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ATG12 antibody was raised against a 15 amino acid peptide from near the center of human ATG12.
Apg12 (ATG12) Rabbit Polyclonal Antibody
TA335737

USD 539.00

5 Days

Rabbit Polyclonal Anti-ATG12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ATG12 Antibody: synthetic peptide directed towards the middle region of human ATG12. Synthetic peptide located within the following region: KFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAW