Anti-RALA Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 141-155 amino acids of human v-ral simian leukemia viral oncogene homolog A (ras related) |
Rabbit Polyclonal antibody to RALA (v-ral simian leukemia viral oncogene homolog A (ras related))
| Applications | WB |
| Reactivities | Human, Mouse (Predicted: Rhesus Monkey) |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 206 of RALA (Uniprot ID#P11233) |
Rabbit polyclonal Anti-RALA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RALA antibody: synthetic peptide directed towards the middle region of human RALA. Synthetic peptide located within the following region: GQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV |
Rabbit anti RalA (pS196) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti RalA (Paired S196) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
