Antibodies

View as table Download

Rabbit Polyclonal Anti-MAP3K2 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human MAP3K2

Rabbit polyclonal Anti-MAP3K2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAP3K2 antibody: synthetic peptide directed towards the N terminal of human MAP3K2. Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE