Antibodies

Jump to Filters
View as table Download
PIWIL4 Rabbit Polyclonal Antibody
TA322022

USD 380.00

2 Weeks

Anti-PIWIL4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 546-838 amino acids of human piwi-like RNA-mediated gene silencing 4
PIWIL4 Rabbit Polyclonal Antibody
TA338844

USD 539.00

2 Weeks

Rabbit Polyclonal Anti-PIWIL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR
PIWIL4 Rabbit Polyclonal Antibody
TA338845

USD 539.00

5 Days

Rabbit Polyclonal Anti-PIWIL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PIWIL4 antibody: synthetic peptide directed towards the N terminal of human PIWIL4. Synthetic peptide located within the following region: LSNNEASSSNGFLGTSRISTNDKYGISSGDAGSTFMERGVKNKQDFMDLS