Antibodies

Jump to Filters
View as table Download
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
TA301678

USD 620.00

2 Weeks

Rabbit Polyclonal Antibody against GLUT1

Applications ChIP, FC, ICC/IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
TA312796

USD 380.00

4 Weeks

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.
TGF alpha (TGFA) Rabbit Polyclonal Antibody
TA323258

USD 380.00

In Stock

Anti-TGFA Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-98 amino acids of human transforming growth factor, alpha
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA351797

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-TGFB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TGFB2
MET Rabbit Polyclonal Antibody
TA311751

USD 380.00

4 Weeks

Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific
TGF beta 2 (TGFB2) Rabbit Polyclonal Antibody
TA356540

USD 539.00

5 Days

TGFB2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2
TGF beta 3 (TGFB3) Rabbit Polyclonal Antibody
TA325932

USD 380.00

4 Weeks

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.
MET (C-term) Rabbit Polyclonal Antibody
AP22713PU-N

USD 575.00

2 Weeks

MET (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen MET antibody was raised against a synthetic peptide from C-terminus of human c-Met protein
MET Rabbit Polyclonal Antibody
TA311748

USD 380.00

In Stock

Rabbit polyclonal c-Met (Ab-1003) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific
HGF Rabbit Polyclonal Antibody
TA335250

USD 539.00

5 Days

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP
MET Rabbit Polyclonal Antibody
TA350824

USD 380.00

In Stock

Rabbit Polyclonal Anti-MET Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MET
MET Rabbit Polyclonal Antibody
AP09516PU-N

USD 405.00

2 Weeks

MET rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around amino acids 1001~1005 (V-D-Y-R-A) derived from Human Met.
MET pTyr1234 Rabbit Polyclonal Antibody
AP20840PU-N

USD 495.00

3 Weeks

MET pTyr1234 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Glucose Transporter GLUT1 (SLC2A1) Rabbit Polyclonal Antibody
RA25078-100

USD 745.00

2 Weeks

Glucose Transporter GLUT1 (SLC2A1) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Primate, Rabbit, Rat
Conjugation Unconjugated
MET Rabbit Polyclonal Antibody
TA311750

USD 380.00

In Stock

Rabbit polyclonal Met (Ab-1313) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MET.
Modifications Phospho-specific