Antibodies

View as table Download

Rabbit Polyclonal Anti-Atp6v0a1 Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-Atp6v0a1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TLNFGGIRVGNGPTEEDAEIIQHDQLSTHSEDAEEPTEDEVFDFGDTMVH

Rabbit Polyclonal Anti-ATP6V0A1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0A1 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A1. Synthetic peptide located within the following region: RDLNPDVNVFQRKFVNEVRRCEEMDRKLRFVEKEIRKANIPIMDTGENPE