Antibodies

Jump to Filters
View as table Download
ETS1 Rabbit Polyclonal Antibody
TA330028

USD 485.00

5 Days

Rabbit Polyclonal Anti-ETS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
ETS1 (N-term) Rabbit Polyclonal Antibody
AP51470PU-N

USD 580.00

2 Weeks

ETS1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 46-74 amino acids from the N-terminal region of Human ETS1
ETS1 Rabbit Polyclonal Antibody
TA329150

USD 539.00

5 Days

Rabbit Polyclonal anti-ETS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG