Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801) |
Rabbit Polyclonal Anti-ABP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF |
Rabbit Polyclonal Anti-CNDP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CNDP1 antibody: synthetic peptide directed towards the C terminal of human CNDP1. Synthetic peptide located within the following region: GSTIPIAKMFQEIVHKSVVLIPLGAVDDGEHSQNEKINRWNYIEGTKLFA |
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) rabbit polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
ABP1 (AOC1) goat polyclonal antibody, Serum
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Human Diamine Oxidase (DAO). |
Active filters
Category
- Antibodies
Clonalities
- Polyclonal
Families
- Secreted Protein
Pathways
- Histidine metabolism