Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-CCR8 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against synthetic 18 amino acid peptide from N-terminal extracellular domain of human CCR8. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Marmoset, Elephant, Panda (83%). |
Rabbit Polyclonal CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR8 antibody was raised against a peptide corresponding to amino acids 183 to 201 of human CCR8, which locate in the second extracellular loop. |
Rabbit Polyclonal Anti-CCR8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCR8 antibody: synthetic peptide directed towards the middle region of human CCR8. Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT |
Rabbit anti CCR8 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |