Antibodies

Jump to Filters
View as table Download
CD162 (SELPLG) Rabbit Polyclonal Antibody
TA349432

USD 380.00

In Stock

Rabbit Polyclonal Anti-SELPLG Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SELPLG
CD162 (SELPLG) (C-term) Rabbit Polyclonal Antibody
AP53840PU-N

USD 580.00

2 Weeks

CD162 (SELPLG) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide between 386-413 amino acids from the C-terminal region of Human SELPLG
CD162 (SELPLG) Rabbit Polyclonal Antibody
TA327127

USD 365.00

3 Weeks

SELPLG Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human SELPLG
CD162 (SELPLG) Rabbit Polyclonal Antibody
TA338244

USD 539.00

5 Days

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the C-terminal region of Human SELPLG. Synthetic peptide located within the following region: EMVCISSLLPDGGEGPSATANGGLSKAKSPGLTPEPREDREGDDLTLHSF
CD162 (SELPLG) Rabbit Polyclonal Antibody
TA338245

USD 539.00

5 Days

Rabbit Polyclonal Anti-SELPLG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SELPLG antibody is: synthetic peptide directed towards the N-terminal region of Human SELPLG. Synthetic peptide located within the following region: GNSLQLWDTWADEAEKALGPLLARDRRQATEYEYLDYDFLPETEPPEMLR