Rabbit Polyclonal Anti-DTX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DTX1 |
Rabbit Polyclonal Anti-DTX1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DTX1 |
Rabbit Polyclonal antibody to Deltex1 (deltex homolog 1 (Drosophila))
Applications | IF, IHC, WB |
Reactivities | Human (Predicted: Mouse, Xenopus, Bovine) |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 343 and 617 of Deltex1 (Uniprot ID#Q86Y01) |
Anti-DXT1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 50-64 amino acids of Human deltex homolog 1 (Drosophila) |
Rabbit Polyclonal Anti-DTX1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DTX1 antibody: synthetic peptide directed towards the N terminal of human DTX1. Synthetic peptide located within the following region: SRWRPYTATVCHHIENVLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQ |