Antibodies

Jump to Filters
View as table Download
SLC25A31 Rabbit Polyclonal Antibody
TA315869

USD 380.00

In Stock

Rabbit polyclonal anti-SLC25A31 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SLC25A31.
SLC25A31 Rabbit Polyclonal Antibody
TA335435

USD 539.00

5 Days

Rabbit Polyclonal Anti-SLC25A31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC25A31 Antibody: synthetic peptide directed towards the N terminal of human SLC25A31. Synthetic peptide located within the following region: LAGGVAAAVSKTAVAPIERVKLLLQVQASSKQISPEARYKGMVDCLVRIP