Antibodies

Jump to Filters
View as table Download
GFUS Rabbit Polyclonal Antibody
TA344243

USD 539.00

5 Days

Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
GFUS Rabbit Polyclonal Antibody
TA314650

USD 380.00

In Stock

Rabbit polyclonal anti-TSTA3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TSTA3.