USD 447.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 447.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal FALDH Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
USD 447.00
In Stock
CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI2A8 (formerly 2A8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 539.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
USD 600.00
3 Weeks
Carrier-free (BSA/glycerol-free) CYP2E1 mouse monoclonal antibody, clone OTI5F11 (formerly 5F11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C5 (formerly 5C5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal Cytochrome P450 8B1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Cytochrome P450 8B1. |
USD 447.00
In Stock
CYP2A6 (Cytochrome P450 2A6) mouse monoclonal antibody, clone OTI5F8 (formerly 5F8)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-COX11 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 115-276 amino acids of human cytochrome c oxidase assembly homolog 11 (yeast) |
Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172) |
USD 600.00
3 Days
Carrier-free (BSA/glycerol-free) CYP2J2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-CYP3A4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
USD 200.00
In Stock
Anti-CYP2E1 (Cytochrome P450 2E1) mouse monoclonal antibody, clone OTI5B9 (formerly 5B9)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
B3GNT2 mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".