Antibodies

Jump to Filters
View as table Download
MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]
TA806846

USD 447.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4A11]
TA806846S

USD 200.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

MMP2 Mouse Monoclonal Antibody [Clone ID: OTI4B11]
TA806847

USD 447.00

In Stock

MMP2 mouse monoclonal antibody, clone OTI4B11 (formerly 4B11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
MMP2 Rabbit Polyclonal Antibody
TA326260

USD 380.00

In Stock

Rabbit polyclonal MMP-2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human MMP-2.
MMP2 (C-term) Rabbit Polyclonal Antibody
AP23331PU-N

USD 560.00

2 Weeks

MMP2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human MMP2
MMP9 Rabbit Polyclonal Antibody
TA326652

USD 570.00

2 Weeks

Rabbit Polyclonal MMP9 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MMP9 antibody was raised against a 16 amino acid peptide near the center of human MMP9.
MMP2 Rabbit Polyclonal Antibody
TA330021

USD 485.00

5 Days

Rabbit Polyclonal Anti-MMP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL