Antibodies

View as table Download

PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue
TA321237 is a possible alternative to TA321238.

Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2

Goat polyclonal Plasminogen antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Plasminogen [Human Plasma]

Rabbit Polyclonal Anti-C2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS

Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified

Applications ELISA, R, WB
Reactivities Human
Conjugation Unconjugated