PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PLAU mouse monoclonal antibody, clone OTI5H4 (formerly 5H4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-PLAT Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Carboxypeptidase B2 (CPB2) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide selected between 119~148 amino acids from the Center region of Human CPB2 |
Goat polyclonal Plasminogen antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Plasminogen [Human Plasma] |
Rabbit Polyclonal Anti-C2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C2 antibody: synthetic peptide directed towards the N terminal of human C2. Synthetic peptide located within the following region: EPICRQPYSYDFPEDVAPALGTSFSHMLGATNPTQKTKESLGRKIQIQRS |
Factor VII (F7) mouse monoclonal antibody, clone RFFVII/2, Aff - Purified
Applications | ELISA, R, WB |
Reactivities | Human |
Conjugation | Unconjugated |