Rabbit Polyclonal Anti-COL1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit anti-GP9 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GP9 |
Collagen VI (COL6A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian |
| Conjugation | Biotin |
| Immunogen | Collagen type VI purified from Human and Bovine placenta. |
Von Willebrand Factor (VWF) goat polyclonal antibody, Purified
| Applications | ELISA, Ie, IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Human von Willebrand Factor (vWF) purified from plasma |
Rabbit Polyclonal Anti-Syndecan4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Syndecan4 Antibody: A synthesized peptide derived from human Syndecan4 |
Rabbit polyclonal anti-SDC2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SDC2. |
Rabbit Polyclonal Anti-SV2A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SV2A antibody: synthetic peptide directed towards the middle region of human SV2A. Synthetic peptide located within the following region: LENQIHRGGQYFNDKFIGLRLKSVSFEDSLFEECYFEDVTSSNTFFRNCT |
Rabbit Polyclonal Anti-Osteopontin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Osteopontin Antibody: A synthesized peptide derived from human Osteopontin |
Germany
Japan
United Kingdom
China
