Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Carrier-free (BSA/glycerol-free) SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 509.00
2 Weeks
Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-SSX2 mouse monoclonal antibody, clone OTI4D10 (formerly 4D10)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-SSX2 mouse monoclonal antibody, clone OTI4A11 (formerly 4A11)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal Anti-SSX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SSX2 antibody: synthetic peptide directed towards the C terminal of human SSX2. Synthetic peptide located within the following region: HRWSSQNTHNIGRFSLSTSMGAVHGTPKTITHNRDPKGGNMPGPTDCVRE |
SSX2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a sequence at the C-terminal of uman SSX2 |
Rabbit Polyclonal Anti-SSX2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SSX2B antibody is: synthetic peptide directed towards the middle region of Human SSX2B. Synthetic peptide located within the following region: MTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTS |
Rabbit Polyclonal Anti-SSX2B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SSX2B antibody is: synthetic peptide directed towards the N-terminal region |
Rabbit Polyclonal Anti-SSX2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SSX2 antibody is: synthetic peptide directed towards the middle region of Human SSX2 |