Rabbit Polyclonal Anti-PDZD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDZD4 antibody is: synthetic peptide directed towards the C-terminal region of Human PDZD4. Synthetic peptide located within the following region: AGRRQHAEERGRRNPKTGLTLERVGPESSPYLSRRHRGQGQEGEHYHSCV |
Rabbit Polyclonal Anti-Pdzd4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pdzd4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pdzd4. Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE |
Germany
Japan
United Kingdom
China