DEPTOR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEPTOR |
DEPTOR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEPTOR |
DEPTOR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DEPTOR |
Rabbit Polyclonal DEPDC6 Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A genomic peptide made to an internal region of the human DEPDC6 protein (within residues 10-200). [Swiss-Prot Q8TB45] |
DEPTOR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DEPTOR |
DEPTOR rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DEPTOR |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR. |
Rabbit Polyclonal Anti-DEPTOR Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DEPTOR antibody is: synthetic peptide directed towards the middle region of Human DEPTOR. Synthetic peptide located within the following region: KSPSSQETHDSPFCLRKQSHDNRKSTSFMSVSPSKEIKIVSAVRRSSMSS |
DEPDC6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human DEPDC6 (NP_073620.2). |
Modifications | Unmodified |
DEPDC6 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human DEPDC6 (NP_073620.2). |
Modifications | Unmodified |