Antibodies

Jump to Filters
View as table Download
RFC5 Rabbit Polyclonal Antibody
TA339306

USD 539.00

5 Days

Rabbit Polyclonal Anti-RFC5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RFC5 antibody: synthetic peptide directed towards the N terminal of human RFC5. Synthetic peptide located within the following region: METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
RFC5 Rabbit Polyclonal Antibody
TA362678

USD 539.00

5 Days

RFC5 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human RFC5