Germany
Japan
United Kingdom
China
Pdpn hamster monoclonal antibody, clone 811, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Pdpn hamster monoclonal antibody, clone RTD4E10, Purified
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the N terminal of human PDPN. Synthetic peptide located within the following region: EGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVAT |
Pdpn rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Mouse soluble Podoplanin (Gly23-Leu141) derived from E. coli (Cat.-No AR31060PU-N) |
Pdpn hamster monoclonal antibody, clone RTD4E10, Biotin
| Applications | IHC, IP, WB |
| Reactivities | Mouse |
| Conjugation | Biotin |
Pdpn rabbit polyclonal antibody, Purified
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Mouse soluble Podoplanin (Gly23-Leu141) derived from E. coli (Cat.-No AR31060PU-N) |
Goat Anti-PDPN Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Dog) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EKVDGDTQTTVEKD, from the internal region of the protein sequence according to NP_006465.3; NP_938203.2; NP_001006625.1; NP_001006626.1. |
Podoplanin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Mouse, Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human Podoplanin |
| Modifications | Unmodified |
Podoplanin Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Podoplanin |
Rabbit Polyclonal Anti-PDPN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PDPN Antibody: synthetic peptide directed towards the middle region of human PDPN. Synthetic peptide located within the following region: VATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVM |
Podoplanin Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Podoplanin |
Rabbit monoclonal to human Podoplanin (Gp36)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- PDPN
Applications
- WB
Isotypes
- IgG