Antibodies

View as table Download

Rabbit Polyclonal Anti-TAB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TAB1

Rabbit Polyclonal TAB1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen TAB1 antibody was raised against a synthetic peptide corresponding to 13 amino acids in the center of human TAB1.

Rabbit anti-MAP3K7IP1 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant Protein of human MAP3K7IP1

Rabbit Polyclonal Anti-TAB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TAB1 antibody: synthetic peptide directed towards the N terminal of human TAB1. Synthetic peptide located within the following region: MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPE