Antibodies

View as table Download

Rabbit Polyclonal Anti-DDX39B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human DDX39B

Rabbit polyclonal anti-DDX39B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDX39B

Rabbit polyclonal anti-DDX39B Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DDX39B

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Rabbit Polyclonal Anti-BAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the C terminal of human BAT1. Synthetic peptide located within the following region: YDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNI

Rabbit Polyclonal Anti-BAT1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-BAT1 antibody: synthetic peptide directed towards the N terminal of human BAT1. Synthetic peptide located within the following region: MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDF