USD 200.00
In Stock
PLA2G2A mouse monoclonal antibody, clone OTI1C2 (formerly 1C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal Anti-PEMT Antibody
| Applications | WB |
| Reactivities | Rat, Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS |
CHPT1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 7-33 aa) of human Cholinephosphotransferase 1/CHPT1. |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit Polyclonal Anti-DGKE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
Rabbit Polyclonal Anti-GDE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
CDS1 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to the N-terminal region of human CDS1 |
Goat Anti-cardiolipin synthase 1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human (Expected from sequence similarity: Mouse, Rat, Dog, Pig, Cow) |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RSALGSALDPLADK, from the internal region of the protein sequence according to NP_061968.1; NP_001120930.1. |
Germany
Japan
United Kingdom
China
