Antibodies

Jump to Filters
View as table Download
GRIA1 Rabbit Polyclonal Antibody
TA325993

USD 380.00

4 Weeks

Rabbit Polyclonal GluR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1
Ionotropic Glutamate receptor 2 (GRIA2) Rabbit Polyclonal Antibody
TA313965

USD 380.00

4 Weeks

Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K).
GRID2 Rabbit Polyclonal Antibody
TA313969

USD 380.00

4 Weeks

Rabbit polyclonal anti-GRID2 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GRID2.
GRIA1 Rabbit Polyclonal Antibody
TA325994

USD 380.00

2 Weeks

Rabbit Polyclonal GluR1 (Ser863) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1 around the phosphorylation site of Serine 863
Modifications Phospho-specific
GRIA1 Rabbit Polyclonal Antibody
TA332438

USD 365.00

3 Weeks

Rabbit anti-GRIA1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA1
Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) Rabbit Polyclonal Antibody
AP08678PU-N

USD 545.00

3 Days

Ionotropic Glutamate receptor 2 (GRIA2) (+ GLUR3) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Chicken, Human, Mouse, Rat, Zebrafish
Conjugation Unconjugated
Immunogen Peptide corresponding to amino acid residues from the C-terminal region of rat GluR2/3.
Ionotropic Glutamate receptor 2 (GRIA2) Rabbit Polyclonal Antibody
TA313966

USD 380.00

2 Weeks

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific
GLUR3 (GRIA3) Rabbit Polyclonal Antibody
TA338509

USD 539.00

5 Days

Rabbit Polyclonal Anti-Gria3 Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM