Antibodies

View as table Download

Rabbit polyclonal MSH2 Antibody (Center)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MSH2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 637-665 amino acids from the Central region of human MSH2.

Rabbit Polyclonal Anti-MSH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG

Mouse monoclonal anti-MSH2 antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-MSH2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: KMSAVDGQRQVGVGYVDSIQRKLGLCEFPDNDQFSNLEALLIQIGPKECV