Antibodies

Jump to Filters
View as table Download
G protein regulated inducer of neurite outgrowth 2 (GPRIN2) Rabbit Polyclonal Antibody
TA334307

USD 539.00

5 Days

Rabbit Polyclonal Anti-GPRIN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE
G protein regulated inducer of neurite outgrowth 2 (GPRIN2) Rabbit Polyclonal Antibody
TA361694

USD 539.00

5 Days

GPRIN2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human GPRIN2