G protein regulated inducer of neurite outgrowth 2 (GPRIN2) Rabbit Polyclonal Antibody

CAT#: TA334307

Rabbit Polyclonal Anti-GPRIN2 Antibody

Product Images

Host: Rabbit; Target Name: GPRIN2; Sample Tissue: MDA-MB-435S Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GPRIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPRIN2. Synthetic peptide located within the following region: LSQSSSSLLGEGREQRPELRKTASSTVWQAQLGEASTRPQAPEEEGNPPE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: G protein regulated inducer of neurite outgrowth 2
• Database Link:
  NP_055511
  Entrez Gene 9721 Human
  UniProt ID O60269
• Background: GPRIN2 may be involved in neurite outgrowth.
• Synonyms: GRIN2; KIAA0514
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Pig: 93%; Guinea pig: 93%; Rat: 92%

Reference Data

• Protein Families: Stem cell - Pluripotency