Rabbit Polyclonal Anti-SLC35E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC35E1 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35E1. Synthetic peptide located within the following region: MMTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNG |
Rabbit Polyclonal Anti-SLC35E1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC35E1 antibody is: synthetic peptide directed towards the C-terminal region of Human SLC35E1. Synthetic peptide located within the following region: MTAILGVFLYNKTKYDANQQARKHLLPVTTADLSSKERHRSPLEKPHNGL |
SLC35E1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SLC35E1 |
Germany
Japan
United Kingdom
China