Antibodies

Jump to Filters
View as table Download
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA309096

USD 545.00

2 Weeks

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH
Collagen I (COL1A1) (1021-1108) Mouse Monoclonal Antibody [Clone ID: 3G3]
AM31694PU-N

USD 535.00

5 Days

Collagen I mouse monoclonal antibody, clone 3G3, Purified from ascites by Protein A

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA309097

USD 545.00

2 Weeks

Rabbit Anti-Collagen 1, alpha 1 telopeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 telopeptide conjugated to KLH
Collagen I (COL1A2) Rabbit Polyclonal Antibody
AP06516PU-N

USD 465.00

3 Weeks

Collagen I (COL1A2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to the N-terminus of Human COL1A2.
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA342814

USD 539.00

5 Days

Rabbit Polyclonal Anti-COL1A1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-COL1A1 antibody: synthetic peptide directed towards the C terminal of human COL1A1. Synthetic peptide located within the following region: PPGPPSAGFDFSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKS
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA336830

USD 550.00

5 Days

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Collagen I protein (between residues 150-200) [UniProt P02452]
Collagen I (COL1A1) Rabbit Polyclonal Antibody
TA336831

USD 550.00

5 Days

Rabbit Polyclonal Collagen I alpha 1 Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal portion of the human Collagen I protein (between residues 1300-1350) [UniProt P02452]